Protein Info for ABID97_RS07605 in Variovorax sp. OAS795

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details PF03006: HlyIII" amino acids 18 to 213 (196 residues), 132.3 bits, see alignment E=1.1e-42 TIGR01065: channel protein, hemolysin III family" amino acids 19 to 217 (199 residues), 184.8 bits, see alignment E=7e-59

Best Hits

Swiss-Prot: 40% identical to YQFA_ECO57: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O157:H7

KEGG orthology group: K11068, hemolysin III (inferred from 94% identity to vap:Vapar_4053)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ABID97_RS07605 hemolysin III family protein (Variovorax sp. OAS795)
MPVRTGKQAAAPRDQTTLEEIFNALSHGLGLLLAIASLPILVYSAAQKGQAASIVGASLF
AGTAIVLYLISTLYHALPMGRAKAWFNRLDHAAIYLFIAGSYMPFLFGVLRGPWGWTLFG
AICAAATLGVGAKLFNRLQHPLWSTGLYVAMGWMALMAAVPLYERMSGAGLGWLVAGGLF
YTAGAVVFLFDNKVRFAHFVWHLFVLAGSACHFFAVLWHSHG