Protein Info for ABID97_RS07595 in Variovorax sp. OAS795

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 310 to 347 (38 residues), see Phobius details amino acids 354 to 379 (26 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 425 to 448 (24 residues), see Phobius details amino acids 476 to 498 (23 residues), see Phobius details amino acids 713 to 733 (21 residues), see Phobius details amino acids 764 to 787 (24 residues), see Phobius details amino acids 799 to 820 (22 residues), see Phobius details PF02687: FtsX" amino acids 268 to 386 (119 residues), 30.3 bits, see alignment E=1.9e-11 amino acids 715 to 828 (114 residues), 39.7 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 94% identity to vap:Vapar_4056)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (838 amino acids)

>ABID97_RS07595 FtsX-like permease family protein (Variovorax sp. OAS795)
MNASLRLGWRTLWRDLRAGELRLLIVAVLLAVAALTAVGFFADRLQGGLQRDARQLLGGD
AVVVSDNPTPDTFIAQARAFGLQGTGTYGFPTMARAEESQGGASKLVALKAVTAGYPLRG
SLQTAASAEAPGTVTRDIPPPGEVWVDASLLDSLGLKVGDPLLLGDTSLRVGRVITLEPD
RGAGFMSFSPRVMLNQADVPRTGLVQPASRVGYRYAVAGDDASVKRFSDWAEATIKKGEM
RGVRLDSFEGGRPEMRQTLDRAEKFLSLVALLAALLSAVAVALAARGFAAGHLDDCAMLR
VLGQSQRTIAFAYSFEFAVVGLVASSLGVAIGFGVHYVFVVLLAGLVETALPAATLWPVA
FGLGMGLTLLFAFGLPPVLQLARVPPLRVIRRDVGGLKPASLAVLGIGVAGFAALLIAAS
SDLKLGLIAVGGFAGAVAVFALLSWLAVKVLRRSVNETTAPRWLVLATRQISARPAYAVV
QVSALAVGLLALVLLVLLRTDLVASWRKATPPDAPNRFVINVMPDQSTAFQKSLRDAGVG
KFDWYPMIRGRLVAVNGKPVSPDDYVEDRAKRLVDREFNLSNSVEAPAHNSIVAGAWKPD
APGEVSVEEGLAETLGLKLGDLLRFDIGGMQNDARITSLRKVDWGSMHANFFVMYTVGAL
PDVPVTYMGAFRAPETRGFDNALVRSYPNVTNVDMSATINQVQRVLDQVIRAVEFLFGFT
LAAGLVVLFAAVTATREERAREFAVMRAVGARASLLRQVQRAELVGVGLLAGFLASIVAS
AIGWGLARYVFDFTWTASPVVPLAGALAGAVLALSAGWWGLRDVLRRPVVDTLRRAAE