Protein Info for ABID97_RS07400 in Variovorax sp. OAS795

Annotation: protein-export chaperone SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02556: SecB" amino acids 4 to 143 (140 residues), 191.5 bits, see alignment E=3.3e-61 TIGR00809: protein-export chaperone SecB" amino acids 7 to 142 (136 residues), 154.2 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 83% identical to SECB_ACIAC: Protein-export protein SecB (secB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 97% identity to vap:Vapar_4100)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>ABID97_RS07400 protein-export chaperone SecB (Variovorax sp. OAS795)
MADQQAQDPVFQIQRVYLKDLSLEQPNSPGILLEQEQPTVDIQLGVDAQPVAEGIFEITV
SATVQTKIQDKTVFLVEAKQAGIFEIRNLPEDQMGPILGIACPQIVYPYLRGNVADVIQR
GGFPPVHLAEINFQAMYEQQQAQAAGQPSPTLAQ