Protein Info for ABID97_RS07370 in Variovorax sp. OAS795

Annotation: AsmA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details PF05170: AsmA" amino acids 20 to 142 (123 residues), 67.5 bits, see alignment E=5.4e-23 amino acids 192 to 552 (361 residues), 134.5 bits, see alignment E=2.7e-43

Best Hits

KEGG orthology group: K07290, hypothetical protein (inferred from 82% identity to vap:Vapar_4106)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (679 amino acids)

>ABID97_RS07370 AsmA family protein (Variovorax sp. OAS795)
MATNVLLRNRLRGGPLWLKLLAAFVLLLVVLAVVLALFPWDRLREPLNRYVSEKTGRKFE
ITRRLDVGIGLRGATVKADGIEFANPPWARDPYLVKAEHAEFDIRLWPLLRQKVVIPRLA
LVSPTLGLQMEADGRRTWALGKDTSDPGTVPVIGVMEIDSGAVDFLAGHLGVDMHADVSY
DTSRGEMPLSYRIKGRYKGQPLTAEGRTGNVLQLKSAGAAPFPLEIDGAAGQTRLKASGT
VTDFAELEGIDAKFDLKGQTLGALFPLLGIALPETSPYALSGDLRKRGKQWEVAGLKGRL
GLSDIAGDMRFDQAGKVPHLGGELRSRVMDMDDLGPLIGLPPTERSAKAVEGVAPPPTIK
QTKRARDARVLPTATLDFDRLRAMNADVKYTADRIKNVRDVPLDRGSVQVKLNNSVLLLE
PLDLGVGGGKLAGAIRIDATQNPADIRASLDLRNVQLNRLVPKIETMRSSFSRLDGRINL
SGRGTSVAGWLGGASGDVAALTGRGRFSNLLLEFMGLDGAEIIKFLLRGDQNVELRCAAV
AFDVNKGVMTSRSMVLDTEDTVFYASGQANLATEKLDFVVRPEPKDRSFLSLRAPLVIGG
TFGAPTGGVQAMPLAERGIAALVLGALNPLLALAATVETGPGEDADCKAVLSQANKPTAG
PAATGASKAKGAKQQQPQR