Protein Info for ABID97_RS07220 in Variovorax sp. OAS795

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 79 to 106 (28 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 277 (184 residues), 67.8 bits, see alignment E=5.3e-23

Best Hits

Swiss-Prot: 64% identical to UGPE_BRUME: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 77% identity to dia:Dtpsy_0789)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>ABID97_RS07220 sn-glycerol-3-phosphate ABC transporter permease UgpE (Variovorax sp. OAS795)
MIERRPGLTVLSHVVLILGIAIVVFPIYLAFVASTHTRDEILRVPMPLVPGTHMVENYTA
ALLGTETQGARVVVGRMMWISLVTALVISIGKIAISLLSAFAIVYFRFPFKKIVFWMIFV
TLMLPVEVRILPTYKVLADLNMLNTYAGLTIPLIASATATFLFRQFFLSVPDELVEAARI
DGAGPMRFFKDILVPLSQTSIAALFVIQFIYGWNQYLWPLLATTTEDMYPVVIGIKRMIA
SGDAAVDWNLVMATAILALIPPAIVVVLMQRWFVKGLVDTEK