Protein Info for ABID97_RS07215 in Variovorax sp. OAS795

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 115 bits, see alignment E=6.2e-37 PF08402: TOBE_2" amino acids 258 to 326 (69 residues), 42.8 bits, see alignment E=7.3e-15

Best Hits

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 93% identity to vap:Vapar_4137)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>ABID97_RS07215 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Variovorax sp. OAS795)
MSAISFRNVIKRYGKGAKANQVIHGVSAEVNKGEFVVIVGPSGCGKSTLLRMVAGLEDIS
AGDIAIGGRVVNLLEPSERDIAMVFQNYALYPHMSVFKNMAYGLKIAKLPTAEIKTRVDK
AAKILELGHLLERKPRELSGGQRQRVAMGRAIVRQPQVFLFDEPLSNLDAKLRAQTRLEI
QKLHRELGITSLFVTHDQVEAMTLAQRIIVMNGGVMDQFATPEEVYNRPATTFVASFIGS
PPMNLLHHAPGVRPGQILGIRPEHMKLDESGWTVQVESVELLGAERLVYGRIGEEQIIMR
TDESDHPPVAGDTVKIAARQDKLHWFDAGSGKRAD