Protein Info for ABID97_RS07150 in Variovorax sp. OAS795

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF12833: HTH_18" amino acids 228 to 306 (79 residues), 88.1 bits, see alignment E=3.8e-29 PF00165: HTH_AraC" amino acids 273 to 305 (33 residues), 29 bits, see alignment 9e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_1116)

Predicted SEED Role

"Transcriptional regulator of various polyols utilization, AraC family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>ABID97_RS07150 AraC family transcriptional regulator (Variovorax sp. OAS795)
MTTTSRKRAIPRQRQPELERDIARSPSLGYEAPETGLVRCLAHGFPSPLVRWHFHEDYEL
HLITETSGKAFIGDWIGPFQPGHLVLCGPRLPHNWISLDVPEGGAAGRDRVIQFRHEPIE
RAAAEIPELREVMQLFERARHGIEFFGMSQQAQSHWDSIKAARGTRRLGLFLEFMADLAQ
CTDYRLLSSVQMQGAQGADGDAQVDQINEIVNRLTANLADSISMSDVAAELGMSESRFSR
FFRRSTGNSFTDFVNRVRINSACHLLMQTDHYVTDICYQVGFNNVANFNRRFLEIKGMTP
SEFRRQADTRFG