Protein Info for ABID97_RS07125 in Variovorax sp. OAS795

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 118.9 bits, see alignment E=4.1e-38 PF08402: TOBE_2" amino acids 264 to 336 (73 residues), 53.5 bits, see alignment E=3.3e-18 PF03459: TOBE" amino acids 284 to 335 (52 residues), 28.1 bits, see alignment 2.9e-10

Best Hits

Swiss-Prot: 50% identical to UGPC_PARDP: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_1111)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>ABID97_RS07125 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Variovorax sp. OAS795)
MAYLQLKDIKKSFGDADIIKGVDLEIRKGEFIVFVGPSGCGKSTLLRLIAGLEPITSGNL
LLDGKDITWTPSGKRDLAMVFQSYALYPHMSVYDNMSFALKLAGVPKGEIKTKVEHAART
LNLTQYLDRTPKDLSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGNTRVEIHKLH
RSLGATTIYVTHDQVEAMTLADRVVVLRDGLIEQVGTPLELYDHPANQFVAQFIGMPSMN
MVAASAIPSFSAATGGRLPDDGFLGVRPEGLRVHPKQTTAAGVPGRVELIEALGADTLIH
VDVGGVPLIARQNERTPLHAGDDVAVELDPSVLHLFNREGRAVSA