Protein Info for ABID97_RS07045 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 94 to 122 (29 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 218 to 244 (27 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 303 (194 residues), 109.4 bits, see alignment E=9.1e-36

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 98% identity to vap:Vapar_1092)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABID97_RS07045 ABC transporter permease (Variovorax sp. OAS795)
MKKTLARWLDSDVGYSFRNSPVAMGAALIALACLFCAAFAGWVSPHNPFDLATLELGDAR
LPPAWSAEGSSKYLLGTDDQGRDILSAVIYGARISLIVGIVSVLLSITVGVVLGLLAGFL
GGWLDSFLMRLCDVMLSFPPILVALLIAGVGRALFPNAHESLAFGVLIISISLTGWVQYA
RTVRGSTLVERNKEYVQAARVTGVAPLRIMLRHVLPNVMGPVMVLATIQVATAIITEATL
SFLGVGVPPTSPSLGTLISIGNQYLFSGEWWITVFPGLMLVLIALSVNLLGDWLRDALNP
RLR