Protein Info for ABID97_RS07000 in Variovorax sp. OAS795

Annotation: threonine ammonia-lyase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 187 to 207 (21 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 21 to 535 (515 residues), 790.3 bits, see alignment E=3.4e-242 PF00291: PALP" amino acids 39 to 323 (285 residues), 254 bits, see alignment E=2.1e-79 PF00585: Thr_dehydrat_C" amino acids 336 to 369 (34 residues), 30.3 bits, see alignment (E = 3e-11) amino acids 385 to 441 (57 residues), 32.5 bits, see alignment 6.3e-12 amino acids 453 to 535 (83 residues), 82.1 bits, see alignment E=2.1e-27

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 98% identity to vap:Vapar_1083)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>ABID97_RS07000 threonine ammonia-lyase, biosynthetic (Variovorax sp. OAS795)
MKTPLEKTVRDVPVPALTPADYLRKILNARVYDVAIESALEKADALSERLGNTVLLKRED
QQPVFSFKLRGAYNKMAHLTSEQLASGVICASAGNHAQGVALGARKLGARAVVVMPVTTP
RLKIDAVRGFGGEVVLHGDSYSDAYLHALELQAQQGLTFVHPFDDPDVIAGQGTIAMEIL
RQHQGRLDAVFVAIGGGGLISGVANYIKAVRPEIKVIGVQMNDSDAMMQSVAARQRVSLA
DVGLFSDGTAVKLVGEETFRIASNLVDEYIAVDTDAVCAAIKDVFVDTRSIVEPAGALAV
AAIKQYVAGHGRHGETYAAILCGANMNFDRLRFVAERAEVGEEREALFAVTIPEERGSFR
RFCELVGEMPASESKETGSTGGALRNVTEFNYRISDAAKAHVFVGLTTSARGESTTIAQN
FNAHGFDAIDLTHDELAKEHLRHLVGGRTGLAHDERLLRFVFPERPGALLKFLSLMRPNW
NISLFHYRNQGADYGRILVGLQVPAGDAAAFDAFLETLGYPYVEETANPAYRLFLQA