Protein Info for ABID97_RS06985 in Variovorax sp. OAS795

Annotation: GspH/FimT family pseudopilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details TIGR01708: type II secretion system protein H" amino acids 9 to 75 (67 residues), 51.2 bits, see alignment E=1.3e-17 PF07963: N_methyl" amino acids 10 to 33 (24 residues), 31.1 bits, see alignment 1.2e-11 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 12 to 33 (22 residues), 28.7 bits, see alignment 8.2e-11 PF12019: GspH" amino acids 48 to 144 (97 residues), 24.2 bits, see alignment E=3.9e-09

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 89% identity to vap:Vapar_1080)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>ABID97_RS06985 GspH/FimT family pseudopilin (Variovorax sp. OAS795)
MPTSAAGSRRLRGFTLLELIVVIAIIAVATAGVSFAMRDSSAARLDREADRLAALLESAR
AQSRASGVAVRWRLVEGGSFVFDGLPPGALPSGWASEGISAQAALANGAPVPAVLLGPDP
IIAPQQIVLYSEGPPARSLRIATDGLRPFTVAAP