Protein Info for ABID97_RS06820 in Variovorax sp. OAS795
Annotation: SDR family oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)
KEGG orthology group: None (inferred from 94% identity to vap:Vapar_1041)Predicted SEED Role
"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (258 amino acids)
>ABID97_RS06820 SDR family oxidoreductase (Variovorax sp. OAS795) MKDSPQLSIHPSLKGRTVFVTGGGSGIGAAIVAAFAAQGARVAFVDIAESASAALARQIG EDGHAAPWWRTCDVRDIGALQKAIADAAAELGDFAVLVNNVASDDRHTLESVTPEYYDNR MAINERPALFAIQSVVPGMRRLGFGSVVNLGSTGWQTKGSGYPCYAIAKSSVNGLTRGLA VDLGKDRIRINTVSPGWVMTDRQVKLWLDDEGEQSLKRNQCLPDKLLPEDIARMVLFLAS DDAKMCTAQEFTVDAGWT