Protein Info for ABID97_RS06765 in Variovorax sp. OAS795

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00583: Acetyltransf_1" amino acids 63 to 151 (89 residues), 56.9 bits, see alignment E=6.2e-19 PF13673: Acetyltransf_10" amino acids 63 to 155 (93 residues), 43.6 bits, see alignment E=7.2e-15 PF13508: Acetyltransf_7" amino acids 69 to 152 (84 residues), 53.4 bits, see alignment E=6.8e-18 PF08445: FR47" amino acids 97 to 153 (57 residues), 26.4 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 37% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 78% identity to vap:Vapar_1034)

MetaCyc: 37% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>ABID97_RS06765 GNAT family N-acetyltransferase (Variovorax sp. OAS795)
MTTTDTASPAARIRMLPGVDDAQARQLADVLADCVEGGASVSFMRPLSRERAAAFWRRVG
EGVARGDRVLLVAEDAQGIVGTVQLLLEMPENQPHRAEVAKMLVHRRARRQGLGAMLMQA
AEQFARERGKTLLVLDTSSAEAERLYARLGWTRLGVIPGFALLPDGAPCGTTYFYRALA