Protein Info for ABID97_RS06715 in Variovorax sp. OAS795

Annotation: S9 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 PF07676: PD40" amino acids 57 to 90 (34 residues), 47.1 bits, see alignment (E = 5.7e-16) amino acids 186 to 216 (31 residues), 21.7 bits, see alignment (E = 5.5e-08) amino acids 233 to 271 (39 residues), 22.6 bits, see alignment 3e-08 PF00326: Peptidase_S9" amino acids 453 to 654 (202 residues), 116.5 bits, see alignment E=4.6e-37 PF01738: DLH" amino acids 493 to 647 (155 residues), 26 bits, see alignment E=2.4e-09

Best Hits

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>ABID97_RS06715 S9 family peptidase (Variovorax sp. OAS795)
MTQHFSVEDLYLHQKILDVHCAPGLELAACAVLSVDCEKDSYVSCIWTFALDGSAARQLT
RAPGRDESPRWSPDGKRLAFLSDRGGSPQVHLIRRDGGEAWQLGAFPQSVSNLRWAPDGR
SLVVAAAVKTDPDLRGARGHGKPPETRRCMPELAWRLPYKEDGVGYLLQREFHLFRLDAA
SGRHTQLTDGAFDVLAFDVSPDGRRIAFARTREGRFAHCNDLWVCDADGRNARRLTHDHA
IVMQPCWSPDGQRIAFTGAREEGDAEPRLWILDLPSGKVRALCEDTVDVADPGSVQWTPD
ASRLVFTRAHRGRHQIVSLDVAQESLQVLAGGDRQLGVFGCSARHFVYSVDHPSLPSELW
ARPRCDEGGEGPGAQPAMERQLSRLNPWWQDRIGIDAHTVEFDVPDGRGGTERIEGWLLR
ARGCTRPQPLLNDVHGGPASYALLDFDTNVFWQVLCARGWAVLALNAVGSASYGRDFCRR
LAGHWGSRDLPQHLAAIERLRADGVSDGRVAISGKSYGGYLSGYATGNSDAFAAAVVMAP
VGNIETHFGTSDGGYYADPFYMASSPAFDRELATRLSPLQHIGKSKTPTLFMQGKDDERC
PKCQSEELFVSLARAGDTPTELVLYPGETHGFLGSGAPSCREDAARRIIDWIVRFSDAPV
QRGTGQERAEEPSAEGRPLHAESG