Protein Info for ABID97_RS06575 in Variovorax sp. OAS795

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 7 to 235 (229 residues), 149.4 bits, E=1.7e-47
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 11 to 202 (192 residues), 72 bits, E=7.7e-24
• PF02358: Trehalose_PPase
  • amino acids 12 to 215 (204 residues), 120.8 bits, E=5.3e-39

Best Hits

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 93% identity to vap:Vapar_0987)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Protein Sequence (254 amino acids)

>ABID97_RS06575 trehalose-phosphatase (Variovorax sp. OAS795)
MPPPLDRDTALFLDFDGTLVALAPTPEAIEVPPALVGLLEDLRDQLGGALAVVSGRQIDA
IDRFLAPLRLPAAGEHGVQRRDPEGRMQEQHAPDLMPILDIANELARVHEGLLVERKHAA
IALHYRLAPQLEAVCRDAMSRAIAGRPQLELMHGKFVFEVKPTGINKGIAIEAFMNEAPF
AGRKPVFAGDDTTDESGFAVVQPRGGIGIKVGSGPSLALHRLESPRAVFEWLVQLRDHLA
APEHKKEATPRSPE