Protein Info for ABID97_RS06565 in Variovorax sp. OAS795

Annotation: alpha,alpha-trehalose-phosphate synthase (UDP-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR02400: alpha,alpha-trehalose-phosphate synthase (UDP-forming)" amino acids 3 to 455 (453 residues), 572.9 bits, see alignment E=2.3e-176 PF00982: Glyco_transf_20" amino acids 17 to 455 (439 residues), 408.8 bits, see alignment E=1.6e-126

Best Hits

Swiss-Prot: 48% identical to OTSA_SINFN: Trehalose-6-phosphate synthase (otsA) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00697, alpha,alpha-trehalose-phosphate synthase (UDP-forming) [EC: 2.4.1.15] (inferred from 97% identity to vap:Vapar_0985)

Predicted SEED Role

"Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (EC 2.4.1.15)" in subsystem Trehalose Biosynthesis (EC 2.4.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ABID97_RS06565 alpha,alpha-trehalose-phosphate synthase (UDP-forming) (Variovorax sp. OAS795)
MSRLVVVSNRVADPRKPAAGGLAVALGESLQQSGGLWFGWSGQIVEDGPTGEGELHRLQA
GKVTLATIDLSREDHDSYYLGYSNDVLWPVFHNRLDLAHFEAGFIGGYRRVNQLFARKLM
PLLKPDDIIWIHDYHLMPLAAELRAMGCTQRIGFFLHIPLPPQIIIAAVPQHEWLMRSLF
SYDLIGFQAQQDVQHFEHYVRNEAHGEYIGDDMYRAYGQTVRCSAFPIGIDVDEFAALTH
GKESRDMFETMKREYSQRRLLLGIDRLDYSKGIPQRVRAFRELLANYPENRRSATLIQIA
SPTRETVDAYGDIRRELESLCGAINGDYGELDWMPVRYIHRMVARKRVPGLCRAAAVGLV
TPLRDGMNLVAKEYIAAQDPADPGVLVLSRFAGAAEQLKEALLVNPYDTHGTAETVQQAL
QMPLEERRERHQKLLSRIREQDIHWWRRSFLDALRHAASQR