Protein Info for ABID97_RS06365 in Variovorax sp. OAS795

Annotation: TlpA disulfide reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 27 (1 residues), see Phobius details PF00578: AhpC-TSA" amino acids 54 to 141 (88 residues), 56.1 bits, see alignment E=5.5e-19 PF08534: Redoxin" amino acids 57 to 166 (110 residues), 60.5 bits, see alignment E=2.5e-20 PF13905: Thioredoxin_8" amino acids 65 to 158 (94 residues), 37.3 bits, see alignment E=4.5e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_0948)

Predicted SEED Role

"Cytochrome c-type biogenesis protein ResA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>ABID97_RS06365 TlpA disulfide reductase family protein (Variovorax sp. OAS795)
MTSSPTRRRLLYGGVAVAAAAAGLGGAWWRERGSRAEGEMLDAAFWSQRFDRPEGGELVF
SDLRGKPLLLNFWATWCPPCVEEMPMIDRFFRENGGNGWQVVGLAIDQPSAVRKFLQKTP
VSYPTGLAGLQGTELVKSLGNTAGGLPFTLVLNGSGAVAARKMGKLEAADLAAWRRDLVH
G