Protein Info for ABID97_RS06330 in Variovorax sp. OAS795

Annotation: rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 187 to 188 (2 residues), see Phobius details amino acids 191 to 207 (17 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 348 (28 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 22 to 379 (358 residues), 406.5 bits, see alignment E=5e-126 PF01098: FTSW_RODA_SPOVE" amino acids 28 to 380 (353 residues), 322.7 bits, see alignment E=1.5e-100

Best Hits

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 97% identity to vap:Vapar_0941)

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>ABID97_RS06330 rod shape-determining protein RodA (Variovorax sp. OAS795)
MSAVFNQPSLARRVAPIFQGFDGFLAFAVLLLAFAGLLTMYSSGYDHGSRFSDHGRNMLL
AGFIMFVVAQVPPQRLMIFAVPLYATGVALLVAVALFGITKKGATRWINIGVVIQPSEIL
KIAMPLMLAWWFQRREGQLRPLDFVVATVLLAVPVGLIMKQPDLGTSLLVLAAGMAVIFF
AGLSWKLIVPPVVLGAIAVTLIVGFESQLCADGVDWRVLHDYQKQRVCTLLDPSKDPLGK
GFHIIQGMIAIGSGGMGGKGFMQGTQTHLEFIPERTTDFIFAAYSEEFGLVGNLALIAAF
ILLIFRGLAIAANATTLFSRLLAGAVTMIFFTYAFVNMGMVSGILPVVGVPLPFISYGGT
AMVTLGLGLGILMSIARARKLAAQN