Protein Info for ABID97_RS06300 in Variovorax sp. OAS795

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR00507: shikimate dehydrogenase" amino acids 3 to 281 (279 residues), 220.2 bits, see alignment E=1.4e-69 PF08501: Shikimate_dh_N" amino acids 6 to 94 (89 residues), 63.6 bits, see alignment E=2.5e-21 PF01488: Shikimate_DH" amino acids 123 to 203 (81 residues), 36.3 bits, see alignment E=8.5e-13 PF18317: SDH_C" amino acids 248 to 277 (30 residues), 42.4 bits, see alignment (E = 7e-15)

Best Hits

Swiss-Prot: 67% identical to AROE_ACIAC: Shikimate dehydrogenase (NADP(+)) (aroE) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 93% identity to vap:Vapar_0935)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>ABID97_RS06300 shikimate dehydrogenase (Variovorax sp. OAS795)
MDLYCVVGNPVEHSRSPRIHARFAELCGQQMDYSRRLVPIGAFAEGIASFRREAAERGDA
ARGCNVTVPFKFDAAAIAQHTSERALLAQAVNTLRFEADGSIHADNTDGIGLVNDIVRNA
AVPLAGRELLLIGAGGAAAGVLGPLLDAGVSRIVVANRTVGKAMALVQRHAALALQRGAT
LEAWALDEVPGTFDIVVNATASSLAGDAVPVHAQVLREGALAVDLMYGPAAAGFMAWAEA
HGGVPRDGLGMLVEQAAEAFEIWRGVRPPGAQVLAELRAALAAGQ