Protein Info for ABID97_RS06220 in Variovorax sp. OAS795

Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 41 to 392 (352 residues), 395 bits, see alignment E=1.5e-122 PF10555: MraY_sig1" amino acids 71 to 81 (11 residues), 22.3 bits, see alignment (E = 6.5e-09) PF00953: Glycos_transf_4" amino acids 102 to 310 (209 residues), 106.9 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 99% identical to MRAY_VARPS: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 98% identity to vpe:Varpa_0976)

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>ABID97_RS06220 phospho-N-acetylmuramoyl-pentapeptide- transferase (Variovorax sp. OAS795)
MLMSLAQWLQTLSPEFGFLRVFQYLTFRALMAALTALVVGLVAGPYVIRRLAALKIGQPV
RGYGMETHLTKSGTPTMGGVLVLFAIAFATVLWFDASNRFVWIVLWVTLGFGAIGWVDDW
RKVVRKDPEGMRSREKYFWQSVVGLIAGFYLLFSISESSNWRVLQLFFAWVQSGFDLDFP
PKINLLVPFFKEVSYPLGGIGFVILTYLVIVGASNAVNLTDGLDGLAIMPVVMVGSALGV
FAYVTGSAVYSKYLLFPNIPGSGELLVFCSAMAGAGLAFLWFNTHPAQVFMGDVGALALG
GALGTIAVIVRQEIVFFIMGGIFVVEAISVMAQVMYFKYTKKRYGEGRRVLKMAPLHHHF
EKSGWRETQVVVRFWIITMLLCLVGLSTLKLR