Protein Info for ABID97_RS05955 in Variovorax sp. OAS795

Annotation: nucleoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01156: IU_nuc_hydro" amino acids 5 to 303 (299 residues), 302.7 bits, see alignment E=1.8e-94

Best Hits

Swiss-Prot: 46% identical to YHD6_SCHPO: Uncharacterized protein C1683.06c (SPBC1683.06c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01239, purine nucleosidase [EC: 3.2.2.1] (inferred from 90% identity to vap:Vapar_0832)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABID97_RS05955 nucleoside hydrolase (Variovorax sp. OAS795)
MPHTLIIDTDPGADDVIALLFAMAAPEALALQALTTVAGNVPLAKTSRNARLACEWAGRP
DIPVYAGAERPLQRTPIHAANIHGREGITGVDVHEPAAPLAEGHAVDYLVRTLRAAPERS
VTLAMLGPQTNLALALGQAPDIARGLRELVLMAGAHFNGGNITPTAEFNVFADPHAAEAV
LQCGVPITMLPLDATHKILTSDARIARLRSIGNRAGRIVADILDAYAPEEMRHYGMPGGP
VHDATVIAYLLQPSLFTGRLVNVEVDSREGMGFGQTVADWHGSLKRPANVNWIVDGDAEG
FFDLLARHIARLP