Protein Info for ABID97_RS05910 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 46 to 319 (274 residues), 143.9 bits, see alignment E=8.2e-46 PF00005: ABC_tran" amino acids 398 to 547 (150 residues), 120.7 bits, see alignment E=7.4e-39

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 97% identity to vap:Vapar_0823)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>ABID97_RS05910 ABC transporter ATP-binding protein/permease (Variovorax sp. OAS795)
MRRSGEALPPPSHPVAGHAPARSDRSDWATLRRLFPYLWQYKWRVIAALAFMVGAKVANV
GVPVLLKNLIDTMTPKPDMAQALLIVPLGLLLAYGLLRFSTALFGELRELIFAKATEGTA
RQIALEVFGHLHSLSLRFHLERQTGGMTRDIERGTRGVHSLISMSLYSIVPTIIELVLVL
TILGVKFDSLFVWITGAALVLYISFTVTVTEWRTQFRKTMNELDSMAQSRAVDSLLNYET
VKYFNNEEFEARRYDASLDRYRKAAIKSQRTLSMLNIGQQLIIATSLVLMLWRATSGVVE
GRMTLGDLVMVNAFMIQLYIPLNFLGVIYREIKQSLTDLDKMFVLMEKEREVRDAPGAQP
LSLLPLPRGEGGGEGSGVDSTVRFEDVSFAYEPARPILKHVSFEIPAGKTVAVVGPSGSG
KSTLARLLYRFYDVQQGRITIGGQDIREVQQSSVRRAIGIVPQDTVLFNDTVEYNIAYGR
PGASREEVENAARAARIHDFISATPLGYETTVGERGLKLSGGEKQRVAIARTLLKNPPIV
IFDEATSALDSANERAIQSELKSAAQDKTTLVIAHRLSTVVDAHEILVLEAGVIVERGTH
AELLAKQGRYAQMWALQKSEATPLM