Protein Info for ABID97_RS05845 in Variovorax sp. OAS795

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 11 to 198 (188 residues), 201 bits, E=2.2e-63
• PF08659: KR
  • amino acids 14 to 173 (160 residues), 59 bits, E=9.2e-20
• PF13561: adh_short_C2
  • amino acids 17 to 230 (214 residues), 148.3 bits, E=4.3e-47

Best Hits

Swiss-Prot: 49% identical to Y432_LISMO: Uncharacterized oxidoreductase Lmo0432 (lmo0432) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_0808)

MetaCyc: 33% identical to 2-hydroxy-indole-3-acetate 3-monooxygenase (Pseudomonas putida 1290)
1.14.13.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• indole-3-acetate degradation I (1/3 steps found)
• indole-3-acetate degradation II (2/7 steps found)

Protein Sequence (252 amino acids)

>ABID97_RS05845 SDR family oxidoreductase (Variovorax sp. OAS795)
MTSVQDNIRGKVAIVTGASSGLGESTARHLAARGAKVVLAARRTDRLDRVVAEIREAGGE
AIAVATDVARRADLEKLAAATIEAFGRIDVLVNNAGVMPLSPIEKLKVDEWDRTIDVNIK
GVLYGIAAVLPRMQAQGSGHIVNVASIAGLKVFTPIGTVYSATKHAVRAISEGLRVEMGR
SGVRVTIVSPGAIESELKFGSSDAESAAGVKAFYEANQIPADSVARAVVYAVEQPADVDI
NEVVLRPVSQEF