Protein Info for ABID97_RS05825 in Variovorax sp. OAS795

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 185 (180 residues), 141.9 bits, E=2.8e-45
• PF13561: adh_short_C2
  • amino acids 13 to 243 (231 residues), 188.1 bits, E=3e-59

Best Hits

Swiss-Prot: 56% identical to BDH2_RAT: 3-hydroxybutyrate dehydrogenase type 2 (Bdh2) from Rattus norvegicus

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_0788)

MetaCyc: 56% identical to 2-dehydro-3-deoxy-D-pentonate/2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-22641 [EC: 1.1.1.434]; 1.1.1.434 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

• D-arabinose degradation IV (4/6 steps found)
• D-xylose degradation VI (3/5 steps found)
• L-fucose degradation III (4/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Protein Sequence (244 amino acids)

>ABID97_RS05825 SDR family oxidoreductase (Variovorax sp. OAS795)
MRLKGKTALVTAAGQGIGHASVLAMAAEGAQVWATDVNEKLLERYAGVANVRTARLDVLD
KDAIGAFFKSLPALDVLFNCAGVVHNGTALDATDKDLEFAFNLNVRAQFWTIQAVLPGML
AAGRGSIINMASVCSSMKGLPNRFVYGTTKAAVLGLTKSVAADYVTRGIRCNAVCPGTVD
TPSLGDRINANEDPEAARKAFIARQPMGRLAQAEEIAPVVVFLASDESVFATGQAFTVDG
GLTI