Protein Info for ABID97_RS05805 in Variovorax sp. OAS795

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 232 to 248 (17 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 351 to 385 (35 residues), see Phobius details amino acids 395 to 423 (29 residues), see Phobius details amino acids 435 to 459 (25 residues), see Phobius details PF06808: DctM" amino acids 5 to 455 (451 residues), 419.2 bits, see alignment E=9e-130

Best Hits

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_0784)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABID97_RS05805 TRAP transporter large permease (Variovorax sp. OAS795)
MLKIFFLVFMAGGIPVAVAMAGASLAYILVSGSLPPFVVIHRMVSGIDSFPLLAVPFFIL
AGNLMNNAGITTRIYNFALALVGWLKGGLGHVNVLGSVIFAGMSGTAIADAAGLGTIEIK
AMKEHGYSTEFAVGVTAASATLGPIIPPSLPFVIYGMMANVSVGALFLAGILPGALLAIL
MMLTVAYFAHRNGWGGDVKFSSTRFFKAMCELAVVIGWPLLIWLLVSKLGTPPQLTVFAG
LASLFVLDRIFKFEALLPIMTPVLLIGGMSTGLFTPTEGAIAACVWAMILGFAWYKTLSW
KMFVKVCLDTIETTSTVLFIVAAASIFGWMLTATGVTTDIASWVLGFTKEAWVFLLLANL
LMLFVGCFLEPTAAITILVPILLPIATQLGVDPIHFGLVMVLNLMIGLLHPPMGMVLFVL
ARVAGLSFERTTMAILPWLIPLLLALVVITYVPSLVLWLPKMFF