Protein Info for ABID97_RS05790 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF00892: EamA" amino acids 156 to 286 (131 residues), 48.9 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 56% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_0781)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABID97_RS05790 DMT family transporter (Variovorax sp. OAS795)
MSEAVSGARAAPSLLQTAGLTAAAMVAFAANSLLCRLALQHQGIDPASFGSIRLVSGALT
LALVVRFRAHPSPAARADWLAAAMLFAYVAFFSFAYLSLPAGTGALILFGAVQLTMLGAG
LGGGERFGPLAWLGFILAAGGLVYLVLPGVAAPPLLGAVLMAIAGVAWGVYSLRGRGVAD
PLAATSRNFLRAVPLALALSLAFAARAHADAAGIALAVASGALTSGLGYVIWYAALARLS
AMQAATVQLSVPLLAAIGGVLLLSEAITPRLAAASVAILGGIAIVLSQKSRNARR