Protein Info for ABID97_RS05770 in Variovorax sp. OAS795

Annotation: nucleoid occlusion factor SlmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00440: TetR_N" amino acids 37 to 81 (45 residues), 46.5 bits, see alignment 2.5e-16 PF22276: SlmA-like_C" amino acids 112 to 214 (103 residues), 99.5 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 52% identical to SLMA_VIBVU: Nucleoid occlusion factor SlmA (slmA) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K05501, TetR/AcrR family transcriptional regulator (inferred from 94% identity to vap:Vapar_0777)

Predicted SEED Role

"Transcriptional regulator SlmA, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABID97_RS05770 nucleoid occlusion factor SlmA (Variovorax sp. OAS795)
MQNDETGYPGVETSTETPTTAAPARKRPKPGERRVQILQALAAMLEQPGAERVTTAALAA
RLDVSEAALYRHFASKAQMFEGLIDFIEQSVFTLVNQILEREGATGAQQAARILTLLVQF
AERNPGMTRVMVGDALVFENERLQQRMNQFFDKIEATLRQVLRGAASADGSTTPTVDAQV
RAAALTAFVVGQLQRFARSGFRRAPSEHLEATIALIV