Protein Info for ABID97_RS05765 in Variovorax sp. OAS795

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF08659: KR" amino acids 5 to 136 (132 residues), 27.7 bits, see alignment E=9.8e-10 PF01370: Epimerase" amino acids 6 to 257 (252 residues), 195.5 bits, see alignment E=4e-61 PF04321: RmlD_sub_bind" amino acids 6 to 166 (161 residues), 46.8 bits, see alignment E=8.5e-16 PF02719: Polysacc_synt_2" amino acids 6 to 186 (181 residues), 51.4 bits, see alignment E=3.8e-17 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 6 to 337 (332 residues), 445.6 bits, see alignment E=4.2e-138 PF16363: GDP_Man_Dehyd" amino acids 7 to 326 (320 residues), 195.2 bits, see alignment E=8.3e-61 PF01073: 3Beta_HSD" amino acids 7 to 162 (156 residues), 57.4 bits, see alignment E=4.8e-19 PF13460: NAD_binding_10" amino acids 10 to 162 (153 residues), 27.3 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 61% identical to GALE_YERPE: UDP-glucose 4-epimerase (galE) from Yersinia pestis

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 92% identity to vap:Vapar_0776)

MetaCyc: 58% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABID97_RS05765 UDP-glucose 4-epimerase GalE (Variovorax sp. OAS795)
MVQSSVLVTGGAGFIGSHTCVALAAAGYTPVILDNLGNSDARVLDRLRRITGSAPRLIEG
DVRDKALLDRVLAGERFSAVIHFAGLKAVGDSVADPLTYYDNNVHGSLVLAAAMQQAGVH
TLIFSSSATVYGEPDHSPIPEDAPCRPANPYGRSKRMVEEALADLHHAQPGWRIALLRYF
NPVGAHESGLIGEHPHGKPNNLMPFVCQVAVGQRDKLLIHGNDYPTPDGTGVRDYVHVMD
LAEGHVAALRHAEKQAGLVTLNLGTGHGASVLEVVHAFERASGRPLAYEVGPRRPGDVPA
YWGDPSLAAATLGWRARRGLDQMCADSWRWQQGNPNGYQ