Protein Info for ABID97_RS05740 in Variovorax sp. OAS795

Annotation: glycosyltransferase family A protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 292 to 309 (18 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 19 to 229 (211 residues), 46.6 bits, see alignment E=7.6e-16 PF10111: Glyco_tranf_2_2" amino acids 23 to 208 (186 residues), 60.8 bits, see alignment E=3.1e-20 PF00535: Glycos_transf_2" amino acids 23 to 187 (165 residues), 100.4 bits, see alignment E=2.2e-32 PF02709: Glyco_transf_7C" amino acids 177 to 217 (41 residues), 24.3 bits, see alignment 4e-09

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_0769)

Predicted SEED Role

"Beta-1,3-glucosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>ABID97_RS05740 glycosyltransferase family A protein (Variovorax sp. OAS795)
MTLPTPPAAPAADRTFPWPSVVVIIPFYNGADFIERSVRSVFEQSVPAAEVIVVNDGSRP
EERAALDALVQRYPFRIIDKENGGQGSARNAGVAASTSDFICFLDQDDFYLPNHIETLAS
SIPHGDGLFGFVYADLYEADADGNVVRTGVVKEHATHPKQNINDLLRHDMFVLPSATLIS
RKAFEAVGGFDSQFMGFEDDDLFLRVFRKGFSNHFVDQAVTVWCIHTASTSFGIRMIRSR
FKYFKKLVQMFPDEHQRGRYYFRDCLVPRFQPYFVNHAIESIKNDDQYREEMSAILFEYG
AMVLANPYVGRKKKLRLRLTLFLLRHSSPGLVRLVGAVTRLPGIRSLRKLYS