Protein Info for ABID97_RS05720 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 27 to 227 (201 residues), 57.4 bits, see alignment E=7.6e-20

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 91% identity to vap:Vapar_0765)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ABID97_RS05720 ABC transporter permease (Variovorax sp. OAS795)
MTQEIHSNLHRSALSDWWEGTRRTDIWWTLAWFDIVLRYRRSMLGPIWLTLSMGAMIGGM
GPLYSSLFGTELSKFFPHLALGIIFWGFFASVVSEACNAFVGSSNYLKQGYFPISLFVWR
SIARNLIQFAHQIVLYIPVALWAGISLSWSALLIFPAMLIAIVNAHALGLLLGLICTRFR
DVTQIVTSVMQMLMFLTPVFWLPETLPQRAQYILWNPFAQMLDLLRTPLMGGVAELHSWL
GILVWTAVSVVGSTLLFVKYRRRVVYWL