Protein Info for ABID97_RS05630 in Variovorax sp. OAS795

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 193 (179 residues), 33.1 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0747)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>ABID97_RS05630 LysE family translocator (Variovorax sp. OAS795)
MNWQEFTALLVLATAMSFSPGPNTTLSTALAANGGLPRAMRFVMAVPVGWTLLLVLCAAG
IGALVVAVPALRLAIKVLGVGYLLWLACKLSGSGTLGRADGANLNIGFGQGVMLQFVNIK
AWLLALTLVAGWIAGQPDALGRFAIVAPVMLVYAFVSNFTYALAGALLRDWLAKGRRLLW
FNRTMALVLVLTAWWMLSV