Protein Info for ABID97_RS05370 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 83 (28 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details PF00672: HAMP" amino acids 331 to 381 (51 residues), 34.8 bits, see alignment 4.3e-12 PF00512: HisKA" amino acids 530 to 598 (69 residues), 45.1 bits, see alignment E=2.1e-15 PF02518: HATPase_c" amino acids 640 to 744 (105 residues), 76.6 bits, see alignment E=5.2e-25 PF13581: HATPase_c_2" amino acids 659 to 731 (73 residues), 27.4 bits, see alignment E=7.2e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_0593)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>ABID97_RS05370 ATP-binding protein (Variovorax sp. OAS795)
MSTKPRSGAAATPAARRARAMRWAIGVGAALVTAIGLVLMFLLAQATNNRALYERYYVRL
FGINVVVAVLLVLVIGWVAFRLLRRLRQGKFGSRLLIKLAAIFALVGVVPGALVYVVSYQ
FVARSIESWFDVKVEGALDAGLNLGRATLDSLTDDLAAKTRAASAQLVQVPDASAGLALE
RIRDQLQASDVVLWTGTGQLVASAGTSRFQLNPERPTIQQLRQVRADRAIAHIEGLDETA
PPGATLPPASVRALAMVQRPGFDFDTAPRFLQVTQPLPPAVVANALAVQEANREYQERAL
AREGLRRMYIGTLTLSLFLAVFGAVLLAVLFGNQLARPLLVLADGVRQVAAGDLRPTTVL
QGKDELGGLTRSFAVMTQQLADARGAVEKTMGQLDAARANLQTILDNLTSGVIVLDVKGT
ILSTNPGATRVLRAPLAAYEGMPLAEVPGLADFGTSVQQQFDEFQVERLQHGLDHWQHAF
ELHATGMDLPQQDSAINIVARGAELPGAARLLVFDDISEIVSAQRAQAWGEVARRLAHEI
KNPLTPIQLSAERLEMKLSGKVAPPEQAILVKSVKTIVDQVDAMKRLVNEFRDYARLPAA
DLKAIDLNALLVDVLQLYSAENAPIALRSELDERCPPIRGDAQQIRQVIHNLLQNAQDAA
EAAANSTGRAGEVVIRTRLGDSGQRVRLTVQDSGPGFAENILKRAFEPYVTTKTKGTGLG
LAVVKKIADEHGARIELSNRVVDGAVAGAQVSLSFALAGESHAAVAHTEDSKSSAA