Protein Info for ABID97_RS05180 in Variovorax sp. OAS795

Annotation: type VI secretion system contractile sheath small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR03358: type VI secretion protein, VC_A0107 family" amino acids 6 to 161 (156 residues), 190.2 bits, see alignment E=1.1e-60 PF05591: T6SS_VipA" amino acids 10 to 160 (151 residues), 194 bits, see alignment E=6.9e-62

Best Hits

KEGG orthology group: K11901, type VI secretion system protein ImpB (inferred from 89% identity to vpe:Varpa_0586)

Predicted SEED Role

"Uncharacterized protein ImpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>ABID97_RS05180 type VI secretion system contractile sheath small subunit (Variovorax sp. OAS795)
MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLSGKPVDPLAPVADRKF
LEIDTDNFDSRMKAMKPRAAFSVPNTLTGEGDLKVDITFENMEDFSPAAVARKVDALSKL
LEARTQLSNLVTYMDGKGGAEDLLAKVLEDPALLATLAASKKPEDGTAPAA