Protein Info for ABID97_RS05155 in Variovorax sp. OAS795

Annotation: type VI secretion system-associated FHA domain protein TagH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 PF00498: FHA" amino acids 28 to 94 (67 residues), 41.2 bits, see alignment E=1.8e-14 TIGR03354: type VI secretion system FHA domain protein" amino acids 271 to 558 (288 residues), 192 bits, see alignment E=1.7e-60 PF20232: T6SS_FHA_C" amino acids 384 to 557 (174 residues), 197.5 bits, see alignment E=1.7e-62

Best Hits

KEGG orthology group: K07169, FHA domain-containing protein (inferred from 81% identity to vpe:Varpa_0581)

Predicted SEED Role

"Uncharacterized protein ImpI/VasC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>ABID97_RS05155 type VI secretion system-associated FHA domain protein TagH (Variovorax sp. OAS795)
MIHIAVITRQGAPAGQPIAADFGPNGGTIGRADTNTLVLADPDRTVSRVHAQVLCRDGQY
FVIDRGSNPMQCNGVPLGSGKEAALTDGTQLVVGSFELRVRALAGVAPPSLAVPNTVMKA
PAATAAVSSDDPFADLLAGLAPPPPPSAPGAAPKASPADSLLFPDPMQSGSRNAQAAQVD
PFANLLGPASSSAPSSPPGTNFGGLDDFSDLGAPPAHRKAAGIDELFGGMGGMGGIGGDP
LALSPLADPLLQPNTASDADPLAALQRAAPATPVPRADHLPIDQFGFTPPKAITAPPPAP
PPPPAAPAMPRVELPQFDDITGQPIRISGPDVALREPIEPLLPPTPPAPRPQPVAAARAA
GPAAQRTASDDELLAAFVRGLASTHQTPEMLTPGLMERIGSILRSATEGTLQLLLTRQEF
KREVRAEVTMIASQANNPLKFSPTVEVALAHLLGPGVRGFMPPEAAMRDAFNDLRAHQFG
VMVGMRAALAHVIARFEPEELEKKIASRSALDALFSANRKAKLWDQFVALYGGIASEAED
DFHNLFGKAFLEAYEEQMARLKADVPPAGN