Protein Info for ABID97_RS05010 in Variovorax sp. OAS795

Annotation: MltA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF03562: MltA" amino acids 158 to 212 (55 residues), 34.7 bits, see alignment 1.8e-12 amino acids 239 to 315 (77 residues), 67.4 bits, see alignment E=1.6e-22 PF06725: 3D" amino acids 419 to 492 (74 residues), 73.4 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 90% identity to vap:Vapar_0520)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>ABID97_RS05010 MltA domain-containing protein (Variovorax sp. OAS795)
MYTQSPIFVSTLRWAAVAAAVLAAGCANTPAGNAGASAGTATAAPDTTATPPAATPRPAA
TGGSVAGQARTFSTQLATYTSVSFDAVPGWARDDFSESWPAFLGSCKVLTGRGAEWKDVC
ARALRVDSKNNTAIRAFFEQEFSAYQIRDDDRKPDGVVTGYFEPEIAGSRQYAAPYIYPV
YGQPEDMLFADVRKLPAGNGTVAARVEGRNVVVQTGLSTRDMGAPGLYALDLSALTRDTL
DRKVRLRIEGKQLLPYYTREEIETKGAPNAKVLAFVSSATALYEMQIQGSGRIKLANGDI
VRVAYAEQNGQPFRPTLAQAANGKPRSPVKVRGSSIELQLDDGDEDDDVGSTSTSTIRTR
GFTLARPVTSGAVVVPGRRAAGPVAGSGIQDPSYVFFKESPSPSGGPVGAFGVPLSAGRS
IAVDPRSTPLGYPVFVSTRAPGTGAPMQRLTIAQDTGGAIRGAVRADYFFGNGQQAATNA
RRMKERGQLWILLPRGLAVASASVSSAIRTRGGPVGAGLPQCLVPTEGVCVDD