Protein Info for ABID97_RS04895 in Variovorax sp. OAS795

Annotation: site-specific recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 transmembrane" amino acids 346 to 369 (24 residues), see Phobius details amino acids 371 to 372 (2 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details amino acids 481 to 503 (23 residues), see Phobius details amino acids 543 to 568 (26 residues), see Phobius details amino acids 598 to 622 (25 residues), see Phobius details PF10136: SpecificRecomb" amino acids 23 to 657 (635 residues), 734.6 bits, see alignment E=4.9e-225

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_0492)

Predicted SEED Role

"Site-specific recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>ABID97_RS04895 site-specific recombinase (Variovorax sp. OAS795)
MAAASLDLQGLLARLDPTADVAQRHIWLIDVFDWLRGDRASPQAAAGRVSLLLGAIEARP
EMRARLRAWWQAFTQTVDLTTLLADYGFAPRTAFLSEFSERLRRKILPGTPETTDASDLF
RMVLPGVFDAGWIALLDEDQLARIADLLADSDPADEGGAPRWRHTVMDAVTYCSSQVVAA
GFSPELRLRMSQSRAFHSLMSDLDALREEMFAPPADPGGGEAALQAAFVAFRDRLDACRA
SASSVYTHLEDNGISVGLVFRLRQLRERVLRIRELLDCLMSAAPAPSVARLVGRLVLAGG
ERNSIRALIATNSSMLAAKVTERSAETGEHYITRDRGSYLRMVRQAAGGGALTAVTVMLK
FGIYAIGLSAFWSGFWSGLMYAASFVAIQLLHLTLATKQPAMTAPAMAARLRDIKSDAAV
SDFVDEVTHLVRSQAAAVLGNVGVVVPAMLVLALLAQLALGRPLLDAAHAGATLQSLSLL
GPTALFAALTGVLLFAASIVAGWTENAFVLHRLDSAMRYNPRIGAFLGAARARRWATFMR
THISGFASNISLGLMLGLLPAFAGFFGLGLEVRHVTLSAGQIAAAAASLGMPVLHQPALW
WAVAAIPVIGVLNVSVSFYFAFRLALRAHSVSLGDRARIRSAIRARWRSRPISFFLPA