Protein Info for ABID97_RS04890 in Variovorax sp. OAS795

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 31 to 387 (357 residues), 60.2 bits, see alignment E=8.4e-21

Best Hits

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_0491)

Predicted SEED Role

"Transporter, monovalent cation:proton antiporter-2 (CPA2) family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABID97_RS04890 cation:proton antiporter (Variovorax sp. OAS795)
MNLTSLFNDLLGFWSEWLRPSAGLPTVLWSLLLAAAAAAGHLVQRYLGLPKVVGYSAVGA
VVGLAGFEGAIWPLRGISLFLLELGAAVVLFEAGGRLPLRWFRHNPMVLVQSLLEATLTY
FGVFWMLQLLGLPDPVANPIALMAIVASPAVLSRVIIDTRASGPVTERAMTLATLNTFYA
LALGYAQAGLIERAPQTMLQKLYPVAVVLGLSFVIGGILALALRTALRFMSPTSENTSIL
LLALIAAASALTAHVGGSAPLAALIGGVLLKTLNPKPWAWQRQLGTASSLLTMLMFVLVS
IVAAQADWTLPVASVVLAVIGIRLVAKIAGVAIANPGSGASWNQAFWVGCAMSPLSSIAL
LIASNFTTASPLLGTMITQVALPSILLMEVLGAVIATVAIHAVGESSVPWTPQAFSTTED
TQR