Protein Info for ABID97_RS04885 in Variovorax sp. OAS795

Annotation: YbdK family carboxylate-amine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF04107: GCS2" amino acids 49 to 326 (278 residues), 198.7 bits, see alignment E=7.2e-63 TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 49 to 332 (284 residues), 326.4 bits, see alignment E=8.2e-102

Best Hits

Swiss-Prot: 81% identical to GCS2_POLNA: Putative glutamate--cysteine ligase 2 (Pnap_3664) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 99% identity to vap:Vapar_0490)

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABID97_RS04885 YbdK family carboxylate-amine ligase (Variovorax sp. OAS795)
MTAAMPLSGHTPPRVDPDSDDFRSAALPADPASRVVQLEPFNRSEALSLGVELELQLVNT
HDYDLAPYAEDMLRLMAQTPLPGSVVPEMTSSMIEISTDICHSAQDVIKQLSPIREALIK
NADKLNIAVVGGGTHAFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHIGCPDAD
AALLMLHRMSRYIPHFIALSASSPFVQGQDTQFDSARLNSVFAFPLSGRAPFTLSWKEFE
AYFERMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERAAALAGYVQSLAAWFL
QEQPFEPTEDDYLVYTYNRFQACRFGLDAVYVDPASGQHMPLRDHILMTMTQLEWHSEAL
NATQALGELRTSVEANRNDARWLREKQGKERLLAEVVRQASLRFRGAA