Protein Info for ABID97_RS04765 in Variovorax sp. OAS795

Annotation: thiol:disulfide interchange protein DsbA/DsbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 49 to 190 (142 residues), 37 bits, see alignment E=4e-13 PF01323: DSBA" amino acids 54 to 191 (138 residues), 66 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 43% identical to DSBA_BORPA: Thiol:disulfide interchange protein DsbA (dsbA) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 94% identity to vap:Vapar_0463)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>ABID97_RS04765 thiol:disulfide interchange protein DsbA/DsbL (Variovorax sp. OAS795)
MKRRDFSLAATSLGLLSLAGNTAHAQARVPKAGTEYLVLDKRVPVDAPAGKIEVVEFFSY
NCPHCNDFEPQLEAWLKTAPKEVAFRRVPVPFVGNDVEAKQRLYYALEALGKVDEFQPKV
FDAIHKQRQNVNGEANILAWAGANGLDGAKFKDVFSSFGVASKAKRASQLTEAYKVAGVP
ALAVAGRWYVDGELAGNMTKALQVTNYLIGEAKKG