Protein Info for ABID97_RS04600 in Variovorax sp. OAS795

Annotation: glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 17 to 419 (403 residues), 473.2 bits, see alignment E=3.1e-146 PF00171: Aldedh" amino acids 17 to 285 (269 residues), 47.2 bits, see alignment E=6.5e-17 amino acids 322 to 392 (71 residues), 26.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 79% identical to PROA_POLNA: Gamma-glutamyl phosphate reductase (proA) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 97% identity to vap:Vapar_0425)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ABID97_RS04600 glutamate-5-semialdehyde dehydrogenase (Variovorax sp. OAS795)
MNAFNVSEHMQALGLQAKAAAFLMARADAATKNRALKALARRLREAGPGLAESNEKDLAR
ATAAGLPAPMVDRLKLTPKVIETVALGCEQLAGMADVIGEIIGMKQQPSGIRVGQMRVPI
GVFGMIYESRPNVTIEAASLAIKSGNAAILRGGSEAIESNKALALLVSAALAEAGLPVEA
VQLVQTTDREAVGQLIAMPEFVDVIIPRGGKGLIERISRDAKVPVIKHLDGNCHVYVDDT
AEFEMALRIVDNAKTQKYSPCNAAEGLLVSAVVAEDFLPRIAAIFAAKGVEMRCDPVAAR
ILRADESLAPGARIVDAVESDWSEEYLAAVISIKVVAGVDEAIAHINRYSSHHTDAIVTR
DHVHAQRFLREVDSASVMVNASTRFADGFEFGLGAEIGISTDKFHARGPVGIEGLTSLKY
VVLGQGEVRS