Protein Info for ABID97_RS04545 in Variovorax sp. OAS795

Annotation: glycogen debranching protein GlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02100: glycogen debranching enzyme GlgX" amino acids 5 to 663 (659 residues), 852.7 bits, see alignment E=8.5e-261 PF02922: CBM_48" amino acids 9 to 97 (89 residues), 59 bits, see alignment E=7e-20 PF00128: Alpha-amylase" amino acids 178 to 351 (174 residues), 30.5 bits, see alignment E=3.4e-11 PF18390: GlgX_C" amino acids 596 to 658 (63 residues), 29.5 bits, see alignment E=7.8e-11

Best Hits

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 87% identity to vap:Vapar_0414)

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>ABID97_RS04545 glycogen debranching protein GlgX (Variovorax sp. OAS795)
MLGAGSPLPLGASITPGGVNFALAAPNAEAVELCLFDSTGRHEQQRIRLPAFTDGVWHGL
LPGGRAGLVYGYRVHGPWAPHEGHRFNAARVLLDPYAREIVGTYDGSDLFLGHDPADPAQ
RNTRDNGAVALKARVAAPGGAAAVPGHARIAAGDRVLYELHVRGQTRLHPGVPAALRGTY
AGLAEPVVLDHLQRLGVTTLSLMPVQHRADEQRLLAMGLSNYWGYNTIGWFAPEARYWSG
RAGTTPASEFRAMADAVHARGMELVIDVVYNHSAETDEFGPTLSLRGIDNALYYHLRPDD
RTLYANWTGCGNCLDLAEPRVLQLVMDSLRHWTSALGVDGFRFDLAPVLGRGADGGFDPR
APFFAAVAQDPVLSRTLLVAEPWDIGPGGYRLGEFPPGWLEWNDRYRDTQRGFWLRQGRD
GAAGLGDFAHRFTASSAQFAHHGRAPTASVNFITAHDGFTLRDLLSYEERHNLANGEDNR
DGHAHNLGNNCGVEGPSDDPAVQAGRTRLQRALLAVLLLSQGTPMLLAGDELGHSQQGNN
NAYCQDNETTWLAWIGAQEPGSEAAQLGAFVARLAALRREAPALRSTRWWPAEAPEGAAG
IHWLRPDGGPMQAGDWHGGTALAILFGAAPGNEGDWLVLVNAGAEAVSFALPAGAWQCRL
ASDPALDPGTAPPAARTGVVEVPRSSLWIARMQAPAAQRGARLVAEP