Protein Info for ABID97_RS04525 in Variovorax sp. OAS795

Annotation: biopolymer transporter ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF02472: ExbD" amino acids 27 to 148 (122 residues), 116 bits, see alignment E=6.3e-38

Best Hits

Swiss-Prot: 38% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 94% identity to vap:Vapar_0410)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>ABID97_RS04525 biopolymer transporter ExbD (Variovorax sp. OAS795)
MAFGRTSLGSSAAGGGRATGAGGQRPLSDINVTPLVDVMLVLLVIFIITAPLMASSIKLD
LPQTDAGQPNDTPKFVSVSVDAAGKVFLNDQAVNDEELAARLQKAAADSKDTEVQLRADQ
TVPYGKVVALMGIANKAGLSRIGFVTEADAAPQKPR