Protein Info for ABID97_RS04520 in Variovorax sp. OAS795

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 98 to 206 (109 residues), 102.7 bits, see alignment E=6.4e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 95% identity to vap:Vapar_0409)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>ABID97_RS04520 MotA/TolQ/ExbB proton channel family protein (Variovorax sp. OAS795)
MSVLELLTQGDAVSRSVAALLLAMSISSWVVILWKAWLLRGGTRDVLRSIAAFWQSATLT
DAEQRLKAFDRATLVGPAVSAIRLAAAADAGSATLGATTGDRNQRLTRALRGALHGALRR
LQSGQILLATVGATAPFVGLLGTVWGIYGALSGIAGQTGGFTIDKVAGPVGEALVMTAFG
LAVAIPAVLAYNVFGRVIGRIEAELEGFAHDLLGSFGSAPAPAAPPPARPMPVSA