Protein Info for ABID97_RS04495 in Variovorax sp. OAS795

Annotation: PTS sugar transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00359: PTS_EIIA_2" amino acids 7 to 148 (142 residues), 103.1 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 46% identical to PTSN_PSEAE: Nitrogen regulatory protein (ptsN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 97% identity to vap:Vapar_0404)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>ABID97_RS04495 PTS sugar transporter subunit IIA (Variovorax sp. OAS795)
MNRLASILPPAQVLVSVDATSKKRAFEEAGLLFESLHGLGRALITDSLFARERLGSTGLG
HGVAIPHGRIKGLKAPMAAVFQLANPIGFDAPDEQPVGLLIFLLVPEAATQKHLEILSEI
AELLSDAGLREQIKSSNDAAALHGLIANWQSTQVA