Protein Info for ABID97_RS04455 in Variovorax sp. OAS795

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 145 to 175 (31 residues), see Phobius details amino acids 217 to 245 (29 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details PF12911: OppC_N" amino acids 19 to 70 (52 residues), 61 bits, see alignment 7.9e-21 PF00528: BPD_transp_1" amino acids 117 to 300 (184 residues), 114.3 bits, see alignment E=5.7e-37

Best Hits

Swiss-Prot: 64% identical to DPPC_ECOL6: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 96% identity to vap:Vapar_0396)

MetaCyc: 64% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABID97_RS04455 ABC transporter permease subunit (Variovorax sp. OAS795)
MASTDIIAPPVATQAPPGPWREFWTAFSANRGAVIGLATIAALLLVALFAPWIAPHAPNE
TNSAVFLLPPAWQQGGSASYLLGTDAIGRDILSRLMFGARLSLSIGVAVVALSVVAGIVL
GLVAGFFRGVLEIAIMRLMDIVLTLPSLLLAIVIVAILGPGLVNAMLAVAIVVLPHYVRI
TRAAVIAEVSRDYVTAARVSGAGTLRLMFSEVLPNCAAPLIVQASLGISTAILDAAALGF
LGLGAQPPSPEWGTMLADAREFVLRAWWVVTFPGLAILAAVLAFNLLGDGLRDALDPKLK
R