Protein Info for ABID97_RS04330 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 142 (17 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00892: EamA" amino acids 10 to 140 (131 residues), 65.8 bits, see alignment E=2.4e-22 amino acids 154 to 287 (134 residues), 56 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_0377)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABID97_RS04330 DMT family transporter (Variovorax sp. OAS795)
MRTLTTRELALLLFLTLAWGLNWPVMKLGVADYPPLAFRALSIWLGVPVLGLALVVMKVP
FRVPRSAWPELVWLGATNMFIWHACIILAVKALSGGRTAILGYTMPVFSAIIGAVLFSAV
LTRRSWIGVGACAIGVGLLLWHELTDLAGRPGYVALALVAAATWALGTQLLRHTRIGLPT
LTLSFWMTAMTAVVMTVLTLLFERSQWRWPGPVTWASILYNAVLIFGFAHAAWFYLARGL
PPVASTLSVMFIPVLGVFSGAVWLGEVVHWQDWVAVALMMVAIASVLWPSRSAAKA