Protein Info for ABID97_RS04055 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 124.9 bits, see alignment E=3.6e-40 PF08402: TOBE_2" amino acids 277 to 345 (69 residues), 49.7 bits, see alignment E=3.3e-17

Best Hits

Swiss-Prot: 47% identical to FBPC1_RHIME: Fe(3+) ions import ATP-binding protein FbpC 1 (fbpC1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 91% identity to vpe:Varpa_0321)

Predicted SEED Role

"ABC-type spermidine/putrescine transport systems, ATPase components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>ABID97_RS04055 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MSFLRLTDVTKFYGATRAVSAMNLTVEKGEFVSLLGPSGCGKTTTLQMIAGFEAVSGGRI
ELAGKDITHAKANTRGLGIVFQTYALFPHMTVADNVSFGLEMRKMPKAERKERVKQALAL
VHLEAHAARYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDAKLREEMQFELRQIQ
RKVGTTTVMVTHDQSEAMSISDRVVVMEGGCATQIDHPHRVYEHPSTRFISTFVGKANLL
DARVTVCGARSCHVEVGPLTVEVDDTGHASGAAVLMSVRPEKLQLVEAGRGRLDGTVQER
FFLGSQWLYRLRTPAGELTVLSPNDGRDALDEGSATGIDWPAHCTRLLPAESAESAEAAV
AA