Protein Info for ABID97_RS03940 in Variovorax sp. OAS795

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 14 to 282 (269 residues), 142 bits, see alignment E=1e-45 PF04085: MreC" amino acids 132 to 280 (149 residues), 138.3 bits, see alignment E=8.2e-45

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 95% identity to vap:Vapar_0284)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ABID97_RS03940 rod shape-determining protein MreC (Variovorax sp. OAS795)
MPLGTLDRTAPPLFNQGQSALSKLIFFGALALFLMVADARFHLVQPLRAAVGAVLYPVQW
LALKPVQLALGGGRYLEDLQTAQRNEDEARKALMLQAERASQADTLAQDNARLRALLELR
QTTQAPGRAAEVLYDAADPYTRKIVIDQGLTQGVAPGSPVIDAHGVLGQVTQVLPFTSEI
TLVIDRDLSIPVQNTRTGVRSVAFGDASAHGGGLELRFMAANADLQEGDLLSTSGVDGVY
PPGLPVAKIERIERRADSAFARIYCVPLARVTAARYVLVLAPTGAPSAPPAAPAAAVRKK
PEAKPAKADKADKKPAERAR