Protein Info for ABID97_RS03910 in Variovorax sp. OAS795

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 18 to 198 (181 residues), 179.3 bits, E=2.9e-57
• PF00156: Pribosyltran
  • amino acids 49 to 169 (121 residues), 43.2 bits, E=1.3e-15

Best Hits

Swiss-Prot: 79% identical to PYRE_POLNA: Orotate phosphoribosyltransferase (pyrE) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 96% identity to vap:Vapar_0278)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Protein Sequence (227 amino acids)

>ABID97_RS03910 orotate phosphoribosyltransferase (Variovorax sp. OAS795)
MAVDGVESSAVAQDFVQFALDAGVLRFGEFKTKAGRLSPYFFNSGLFDDGAKIARLAGFY
ADRLIESGVEFDMIFGPAYKGIPLGATVAAELARRGRNYPFAYNRKEAKAHGEGGNLVGA
PLKGRVLIVDDVMSAGTAVRESIAAIEAAGATPHAVAIALDRQEKATENGADVDHSAVQY
VRNQLGLAVVAIATLDDLLNYLSGDAATGLGAHRERVLAYRARYGAR