Protein Info for ABID97_RS03875 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 183 to 209 (27 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 285 (269 residues), 112.2 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 96% identity to vpe:Varpa_0278)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>ABID97_RS03875 ABC transporter permease (Variovorax sp. OAS795)
MTADQWIALVAGIVGGALRVGAPFLFVSLGECLTEKSGRINLGLEGVLVLSAMAAFGGAY
LTDSAWLGVLVGAVAGALLALLHGLLCSLDRVNDVATGIALMLLGTGLAFYLGKPLIQPQ
APQIPAIPLGFWSDNPVVRSALQLNALVPLGVLLAVLLWWGFARTRAGLLVRMAGDSAQA
TRALGYSVAGLRIAATTAGGFIAGLGGASLTLFYPGSWNEGISSGQGLIAVALVIFARWS
PLRCVGAALLFGGAGAIGPALQSIGVGWGYHLFNTVPYVLTLVILVFTCKPGTAAAGSPG
ELSSTRS